FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6145, 90 aa
  1>>>pF1KE6145 90 - 90 aa - 90 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1119+/-0.000596; mu= 8.7044+/- 0.036
 mean_var=47.7575+/- 9.404, 0's: 0 Z-trim(110.0): 17  B-trim: 4 in 1/51
 Lambda= 0.185590
 statistics sampled from 11257 (11267) to 11257 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.746), E-opt: 0.2 (0.346), width:  16
 Scan time:  1.290

The best scores are:                                      opt bits E(32554)
CCDS982.1 MLLT11 gene_id:10962|Hs108|chr1          (  90)  596 166.4 2.1e-42


>>CCDS982.1 MLLT11 gene_id:10962|Hs108|chr1               (90 aa)
 initn: 596 init1: 596 opt: 596  Z-score: 874.8  bits: 166.4 E(32554): 2.1e-42
Smith-Waterman score: 596; 100.0% identity (100.0% similar) in 90 aa overlap (1-90:1-90)

               10        20        30        40        50        60
pF1KE6 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS98 MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN
               10        20        30        40        50        60

               70        80        90
pF1KE6 PEGDGLLEYSTFNFWRAPIASIHSFELDLL
       ::::::::::::::::::::::::::::::
CCDS98 PEGDGLLEYSTFNFWRAPIASIHSFELDLL
               70        80        90




90 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:50:48 2016 done: Tue Nov  8 09:50:48 2016
 Total Scan time:  1.290 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]