FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6139, 95 aa
  1>>>pF1KE6139 95 - 95 aa - 95 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7855+/-0.000468; mu= 12.3168+/- 0.029
 mean_var=52.9761+/-10.853, 0's: 0 Z-trim(114.9): 3  B-trim: 6 in 1/50
 Lambda= 0.176211
 statistics sampled from 15477 (15478) to 15477 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.835), E-opt: 0.2 (0.475), width:  16
 Scan time:  1.040

The best scores are:                                      opt bits E(32554)
CCDS10545.1 DEXI gene_id:28955|Hs108|chr16         (  95)  627 165.8 3.7e-42


>>CCDS10545.1 DEXI gene_id:28955|Hs108|chr16              (95 aa)
 initn: 627 init1: 627 opt: 627  Z-score: 870.4  bits: 165.8 E(32554): 3.7e-42
Smith-Waterman score: 627; 100.0% identity (100.0% similar) in 95 aa overlap (1-95:1-95)

               10        20        30        40        50        60
pF1KE6 MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLP
               10        20        30        40        50        60

               70        80        90     
pF1KE6 EDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
       :::::::::::::::::::::::::::::::::::
CCDS10 EDMDQALVDLGVLSDPGSGLYDADSELDVFDAYLE
               70        80        90     




95 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:47:51 2016 done: Tue Nov  8 09:47:51 2016
 Total Scan time:  1.040 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]