FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6131, 63 aa
  1>>>pF1KE6131 63 - 63 aa - 63 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8505+/-0.00045; mu= 7.5476+/- 0.027
 mean_var=41.8606+/- 8.653, 0's: 0 Z-trim(113.6): 8  B-trim: 0 in 0/50
 Lambda= 0.198231
 statistics sampled from 14203 (14206) to 14203 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.834), E-opt: 0.2 (0.436), width:  16
 Scan time:  0.990

The best scores are:                                      opt bits E(32554)
CCDS4063.1 COX7C gene_id:1350|Hs108|chr5           (  63)  420 126.2 1.3e-30


>>CCDS4063.1 COX7C gene_id:1350|Hs108|chr5                (63 aa)
 initn: 420 init1: 420 opt: 420  Z-score: 662.9  bits: 126.2 E(32554): 1.3e-30
Smith-Waterman score: 420; 100.0% identity (100.0% similar) in 63 aa overlap (1-63:1-63)

               10        20        30        40        50        60
pF1KE6 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS40 MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
               10        20        30        40        50        60

          
pF1KE6 LKT
       :::
CCDS40 LKT
          




63 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:43:41 2016 done: Tue Nov  8 09:43:42 2016
 Total Scan time:  0.990 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]