FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE6122, 86 aa
1>>>pF1KE6122 86 - 86 aa - 86 aa
Library: /omim/omim.rfq.tfa
60827320 residues in 85289 sequences
Statistics: Expectation_n fit: rho(ln(x))= 4.6500+/-0.000271; mu= 11.4182+/- 0.017
mean_var=53.1922+/-10.709, 0's: 0 Z-trim(118.8): 11 B-trim: 0 in 0/49
Lambda= 0.175853
statistics sampled from 32112 (32123) to 32112 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.78), E-opt: 0.2 (0.377), width: 16
Scan time: 2.590
The best scores are: opt bits E(85289)
NP_001854 (OMIM: 124089,220110) cytochrome c oxida ( 86) 632 167.3 2.8e-42
>>NP_001854 (OMIM: 124089,220110) cytochrome c oxidase s (86 aa)
initn: 632 init1: 632 opt: 632 Z-score: 880.1 bits: 167.3 E(85289): 2.8e-42
Smith-Waterman score: 632; 100.0% identity (100.0% similar) in 86 aa overlap (1-86:1-86)
10 20 30 40 50 60
pF1KE6 MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
10 20 30 40 50 60
70 80
pF1KE6 YQSLCPTSWVTDWDEQRAEGTFPGKI
::::::::::::::::::::::::::
NP_001 YQSLCPTSWVTDWDEQRAEGTFPGKI
70 80
86 residues in 1 query sequences
60827320 residues in 85289 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Tue Nov 8 09:38:33 2016 done: Tue Nov 8 09:38:34 2016
Total Scan time: 2.590 Total Display time: -0.020
Function used was FASTA [36.3.4 Apr, 2011]