FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE5183, 115 aa
1>>>pF1KE5183 115 - 115 aa - 115 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 5.9466+/-0.000559; mu= 10.0262+/- 0.034
mean_var=96.3066+/-19.074, 0's: 0 Z-trim(116.1): 5 B-trim: 0 in 0/51
Lambda= 0.130691
statistics sampled from 16715 (16719) to 16715 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.824), E-opt: 0.2 (0.514), width: 16
Scan time: 1.870
The best scores are: opt bits E(32554)
CCDS7717.1 RPLP2 gene_id:6181|Hs108|chr11 ( 115) 719 143.8 2.2e-35
>>CCDS7717.1 RPLP2 gene_id:6181|Hs108|chr11 (115 aa)
initn: 719 init1: 719 opt: 719 Z-score: 748.9 bits: 143.8 E(32554): 2.2e-35
Smith-Waterman score: 719; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)
10 20 30 40 50 60
pF1KE5 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS77 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG
10 20 30 40 50 60
70 80 90 100 110
pF1KE5 KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
:::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS77 KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD
70 80 90 100 110
115 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Mon Nov 7 22:22:23 2016 done: Mon Nov 7 22:22:23 2016
Total Scan time: 1.870 Total Display time: -0.050
Function used was FASTA [36.3.4 Apr, 2011]