FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5180, 152 aa
  1>>>pF1KE5180 152 - 152 aa - 152 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9985+/-0.00057; mu= 13.3877+/- 0.034
 mean_var=60.5661+/-11.931, 0's: 0 Z-trim(112.5): 14  B-trim: 0 in 0/49
 Lambda= 0.164801
 statistics sampled from 13210 (13214) to 13210 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.788), E-opt: 0.2 (0.406), width:  16
 Scan time:  1.270

The best scores are:                                      opt bits E(32554)
CCDS12535.1 RPS16 gene_id:6217|Hs108|chr19         ( 146)  543 136.6 5.6e-33


>>CCDS12535.1 RPS16 gene_id:6217|Hs108|chr19              (146 aa)
 initn: 540 init1: 540 opt: 543  Z-score: 705.5  bits: 136.6 E(32554): 5.6e-33
Smith-Waterman score: 543; 94.3% identity (96.6% similar) in 88 aa overlap (1-88:1-88)

               10        20        30        40        50        60
pF1KE5 MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGK
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MPSKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLLEPVLLLGK
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KE5 ERFAGVDIRVRVKGGGHVAQIYGESQELGAWRRWLWEGGLHSAPVPFNCVSFSQLSVSPS
       ::::::::::::::::::::::.  : .                                
CCDS12 ERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLL
               70        80        90       100       110       120




152 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 22:20:43 2016 done: Mon Nov  7 22:20:43 2016
 Total Scan time:  1.270 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]