FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5115, 106 aa
  1>>>pF1KE5115 106 - 106 aa - 106 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8244+/-0.000624; mu= 12.3485+/- 0.038
 mean_var=56.6726+/-11.305, 0's: 0 Z-trim(110.7): 15  B-trim: 0 in 0/51
 Lambda= 0.170368
 statistics sampled from 11806 (11818) to 11806 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.755), E-opt: 0.2 (0.363), width:  16
 Scan time:  1.390

The best scores are:                                      opt bits E(32554)
CCDS4078.1 GLRX gene_id:2745|Hs108|chr5            ( 106)  707 181.0 1.2e-46


>>CCDS4078.1 GLRX gene_id:2745|Hs108|chr5                 (106 aa)
 initn: 707 init1: 707 opt: 707  Z-score: 950.8  bits: 181.0 E(32554): 1.2e-46
Smith-Waterman score: 707; 100.0% identity (100.0% similar) in 106 aa overlap (1-106:1-106)

               10        20        30        40        50        60
pF1KE5 MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS40 MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
               10        20        30        40        50        60

               70        80        90       100      
pF1KE5 LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
       ::::::::::::::::::::::::::::::::::::::::::::::
CCDS40 LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
               70        80        90       100      




106 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:29:08 2016 done: Mon Nov  7 21:29:08 2016
 Total Scan time:  1.390 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]