FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE5107, 103 aa
1>>>pF1KE5107 103 - 103 aa - 103 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 5.0455+/-0.000579; mu= 10.1638+/- 0.035
mean_var=50.3261+/- 9.835, 0's: 0 Z-trim(111.1): 18 B-trim: 0 in 0/50
Lambda= 0.180791
statistics sampled from 12067 (12085) to 12067 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.776), E-opt: 0.2 (0.371), width: 16
Scan time: 1.480
The best scores are: opt bits E(32554)
CCDS45907.1 LSM7 gene_id:51690|Hs108|chr19 ( 103) 681 184.5 9.9e-48
>>CCDS45907.1 LSM7 gene_id:51690|Hs108|chr19 (103 aa)
initn: 681 init1: 681 opt: 681 Z-score: 970.4 bits: 184.5 E(32554): 9.9e-48
Smith-Waterman score: 681; 100.0% identity (100.0% similar) in 103 aa overlap (1-103:1-103)
10 20 30 40 50 60
pF1KE5 MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS45 MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDD
10 20 30 40 50 60
70 80 90 100
pF1KE5 QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
:::::::::::::::::::::::::::::::::::::::::::
CCDS45 QYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA
70 80 90 100
103 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Mon Nov 7 21:23:21 2016 done: Mon Nov 7 21:23:22 2016
Total Scan time: 1.480 Total Display time: -0.010
Function used was FASTA [36.3.4 Apr, 2011]