FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5105, 115 aa
  1>>>pF1KE5105 115 - 115 aa - 115 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.8720+/-0.000577; mu= 10.0371+/- 0.035
 mean_var=94.6620+/-18.890, 0's: 0 Z-trim(116.0): 1  B-trim: 612 in 1/53
 Lambda= 0.131822
 statistics sampled from 16589 (16590) to 16589 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.823), E-opt: 0.2 (0.51), width:  16
 Scan time:  1.650

The best scores are:                                      opt bits E(32554)
CCDS31832.1 RPS26 gene_id:6231|Hs108|chr12         ( 115)  796 159.7 3.7e-40


>>CCDS31832.1 RPS26 gene_id:6231|Hs108|chr12              (115 aa)
 initn: 796 init1: 796 opt: 796  Z-score: 834.4  bits: 159.7 E(32554): 3.7e-40
Smith-Waterman score: 796; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE5 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS31 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFD
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE5 AYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS31 AYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAAPRPPPKPM
               70        80        90       100       110     




115 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:07:26 2016 done: Mon Nov  7 21:07:26 2016
 Total Scan time:  1.650 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]