FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5084, 54 aa
  1>>>pF1KE5084 54 - 54 aa - 54 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.4842+/-0.000213; mu= 9.8818+/- 0.013
 mean_var=49.7599+/- 9.904, 0's: 0 Z-trim(125.3): 1  B-trim: 464 in 1/52
 Lambda= 0.181817
 statistics sampled from 48701 (48702) to 48701 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.903), E-opt: 0.2 (0.571), width:  16
 Scan time:  3.570

The best scores are:                                      opt bits E(85289)
NP_066950 (OMIM: 604959) phorbol-12-myristate-13-a (  54)  360 100.3 1.6e-22


>>NP_066950 (OMIM: 604959) phorbol-12-myristate-13-aceta  (54 aa)
 initn: 360 init1: 360 opt: 360  Z-score: 525.3  bits: 100.3 E(85289): 1.6e-22
Smith-Waterman score: 360; 100.0% identity (100.0% similar) in 54 aa overlap (1-54:1-54)

               10        20        30        40        50    
pF1KE5 MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_066 MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
               10        20        30        40        50    




54 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 04:52:28 2016 done: Tue Nov  8 04:52:29 2016
 Total Scan time:  3.570 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]