FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3612, 115 aa
  1>>>pF1KE3612 115 - 115 aa - 115 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0976+/-0.000504; mu= 12.9634+/- 0.031
 mean_var=69.7909+/-13.717, 0's: 0 Z-trim(115.7): 6  B-trim: 0 in 0/51
 Lambda= 0.153523
 statistics sampled from 16318 (16319) to 16318 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.84), E-opt: 0.2 (0.501), width:  16
 Scan time:  1.630

The best scores are:                                      opt bits E(32554)
CCDS2696.1 CCK gene_id:885|Hs108|chr3              ( 115)  775 178.9 5.8e-46


>>CCDS2696.1 CCK gene_id:885|Hs108|chr3                   (115 aa)
 initn: 775 init1: 775 opt: 775  Z-score: 938.6  bits: 178.9 E(32554): 5.8e-46
Smith-Waterman score: 775; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE3 MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS26 MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGA
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE3 LLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS26 LLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
               70        80        90       100       110     




115 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 22:50:14 2016 done: Sat Nov  5 22:50:14 2016
 Total Scan time:  1.630 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]