FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3018, 116 aa
  1>>>pF1KE3018 116 - 116 aa - 116 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9733+/-0.000601; mu= 12.8794+/- 0.036
 mean_var=65.7854+/-12.604, 0's: 0 Z-trim(112.5): 4  B-trim: 47 in 1/51
 Lambda= 0.158128
 statistics sampled from 13289 (13291) to 13289 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.789), E-opt: 0.2 (0.408), width:  16
 Scan time:  1.480

The best scores are:                                      opt bits E(32554)
CCDS4011.1 CARTPT gene_id:9607|Hs108|chr5          ( 116)  767 182.5 5.1e-47


>>CCDS4011.1 CARTPT gene_id:9607|Hs108|chr5               (116 aa)
 initn: 767 init1: 767 opt: 767  Z-score: 957.6  bits: 182.5 E(32554): 5.1e-47
Smith-Waterman score: 767; 100.0% identity (100.0% similar) in 116 aa overlap (1-116:1-116)

               10        20        30        40        50        60
pF1KE3 MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS40 MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
               10        20        30        40        50        60

               70        80        90       100       110      
pF1KE3 LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS40 LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
               70        80        90       100       110      




116 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 04:28:01 2016 done: Sun Nov  6 04:28:01 2016
 Total Scan time:  1.480 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]