FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3017, 116 aa
  1>>>pF1KE3017 116 - 116 aa - 116 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2411+/-0.00027; mu= 11.5202+/- 0.017
 mean_var=70.2246+/-13.849, 0's: 0 Z-trim(120.4): 5  B-trim: 38 in 2/54
 Lambda= 0.153049
 statistics sampled from 35524 (35529) to 35524 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.794), E-opt: 0.2 (0.417), width:  16
 Scan time:  5.130

The best scores are:                                      opt bits E(85289)
NP_001039 (OMIM: 182450) somatostatin preproprotei ( 116)  764 176.5 8.7e-45


>>NP_001039 (OMIM: 182450) somatostatin preproprotein [H  (116 aa)
 initn: 764 init1: 764 opt: 764  Z-score: 925.0  bits: 176.5 E(85289): 8.7e-45
Smith-Waterman score: 764; 100.0% identity (100.0% similar) in 116 aa overlap (1-116:1-116)

               10        20        30        40        50        60
pF1KE3 MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
               10        20        30        40        50        60

               70        80        90       100       110      
pF1KE3 NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
               70        80        90       100       110      




116 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 09:13:01 2016 done: Sun Nov  6 09:13:02 2016
 Total Scan time:  5.130 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]