FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE2211, 112 aa
1>>>pF1KE2211 112 - 112 aa - 112 aa
Library: /omim/omim.rfq.tfa
60827320 residues in 85289 sequences
Statistics: Expectation_n fit: rho(ln(x))= 6.7331+/-0.000259; mu= 5.9382+/- 0.016
mean_var=127.4959+/-25.533, 0's: 0 Z-trim(123.6): 2 B-trim: 0 in 0/58
Lambda= 0.113586
statistics sampled from 43783 (43786) to 43783 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.828), E-opt: 0.2 (0.513), width: 16
Scan time: 5.050
The best scores are: opt bits E(85289)
NP_149976 (OMIM: 605902) urocortin-2 preproprotein ( 112) 751 132.3 1.6e-31
>>NP_149976 (OMIM: 605902) urocortin-2 preproprotein [Ho (112 aa)
initn: 751 init1: 751 opt: 751 Z-score: 686.9 bits: 132.3 E(85289): 1.6e-31
Smith-Waterman score: 751; 100.0% identity (100.0% similar) in 112 aa overlap (1-112:1-112)
10 20 30 40 50 60
pF1KE2 MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_149 MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQS
10 20 30 40 50 60
70 80 90 100 110
pF1KE2 HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_149 HCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
70 80 90 100 110
112 residues in 1 query sequences
60827320 residues in 85289 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Mon Nov 7 00:41:14 2016 done: Mon Nov 7 00:41:14 2016
Total Scan time: 5.050 Total Display time: -0.040
Function used was FASTA [36.3.4 Apr, 2011]