FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1606, 112 aa
  1>>>pF1KE1606 112 - 112 aa - 112 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6455+/-0.000514; mu= 13.8168+/- 0.031
 mean_var=59.1048+/-11.545, 0's: 0 Z-trim(114.8): 15  B-trim: 134 in 1/51
 Lambda= 0.166826
 statistics sampled from 15366 (15381) to 15366 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.837), E-opt: 0.2 (0.472), width:  16
 Scan time:  1.720

The best scores are:                                      opt bits E(32554)
CCDS6569.1 CCL27 gene_id:10850|Hs108|chr9          ( 112)  777 193.9 1.7e-50


>>CCDS6569.1 CCL27 gene_id:10850|Hs108|chr9               (112 aa)
 initn: 777 init1: 777 opt: 777  Z-score: 1020.0  bits: 193.9 E(32554): 1.7e-50
Smith-Waterman score: 777; 100.0% identity (100.0% similar) in 112 aa overlap (1-112:1-112)

               10        20        30        40        50        60
pF1KE1 MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS65 MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG
               10        20        30        40        50        60

               70        80        90       100       110  
pF1KE1 DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
       ::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS65 DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
               70        80        90       100       110  




112 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 15:31:01 2016 done: Mon Nov  7 15:31:02 2016
 Total Scan time:  1.720 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]