FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1605, 109 aa
  1>>>pF1KE1605 109 - 109 aa - 109 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6532+/-0.000601; mu= 12.7882+/- 0.036
 mean_var=51.3536+/- 9.851, 0's: 0 Z-trim(110.4): 44  B-trim: 70 in 1/50
 Lambda= 0.178974
 statistics sampled from 11570 (11614) to 11570 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.76), E-opt: 0.2 (0.357), width:  16
 Scan time:  1.570

The best scores are:                                      opt bits E(32554)
CCDS3582.1 CXCL13 gene_id:10563|Hs108|chr4         ( 109)  727 194.6 9.9e-51


>>CCDS3582.1 CXCL13 gene_id:10563|Hs108|chr4              (109 aa)
 initn: 727 init1: 727 opt: 727  Z-score: 1024.2  bits: 194.6 E(32554): 9.9e-51
Smith-Waterman score: 727; 100.0% identity (100.0% similar) in 109 aa overlap (1-109:1-109)

               10        20        30        40        50        60
pF1KE1 MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS35 MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
               10        20        30        40        50        60

               70        80        90       100         
pF1KE1 PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
       :::::::::::::::::::::::::::::::::::::::::::::::::
CCDS35 PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
               70        80        90       100         




109 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 17:28:07 2016 done: Sun Nov  6 17:28:07 2016
 Total Scan time:  1.570 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]