FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1603, 104 aa
  1>>>pF1KE1603 104 - 104 aa - 104 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0307+/-0.000597; mu= 11.5249+/- 0.036
 mean_var=62.2356+/-12.332, 0's: 0 Z-trim(111.8): 4  B-trim: 0 in 0/51
 Lambda= 0.162575
 statistics sampled from 12672 (12675) to 12672 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.774), E-opt: 0.2 (0.389), width:  16
 Scan time:  1.670

The best scores are:                                      opt bits E(32554)
CCDS4456.1 SCGB3A1 gene_id:92304|Hs108|chr5        ( 104)  642 158.0 9.7e-40


>>CCDS4456.1 SCGB3A1 gene_id:92304|Hs108|chr5             (104 aa)
 initn: 642 init1: 642 opt: 642  Z-score: 826.9  bits: 158.0 E(32554): 9.7e-40
Smith-Waterman score: 642; 100.0% identity (100.0% similar) in 104 aa overlap (1-104:1-104)

               10        20        30        40        50        60
pF1KE1 MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS44 MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL
               10        20        30        40        50        60

               70        80        90       100    
pF1KE1 LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
       ::::::::::::::::::::::::::::::::::::::::::::
CCDS44 LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG
               70        80        90       100    




104 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 17:01:31 2016 done: Sun Nov  6 17:01:31 2016
 Total Scan time:  1.670 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]