FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1580, 85 aa
  1>>>pF1KE1580 85 - 85 aa - 85 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.4551+/-0.0005; mu= 8.4313+/- 0.030
 mean_var=64.2337+/-12.522, 0's: 0 Z-trim(114.8): 2  B-trim: 0 in 0/53
 Lambda= 0.160027
 statistics sampled from 15366 (15367) to 15366 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.83), E-opt: 0.2 (0.472), width:  16
 Scan time:  1.350

The best scores are:                                      opt bits E(32554)
CCDS6790.1 CDC26 gene_id:246184|Hs108|chr9         (  85)  559 136.2 2.3e-33


>>CCDS6790.1 CDC26 gene_id:246184|Hs108|chr9              (85 aa)
 initn: 559 init1: 559 opt: 559  Z-score: 712.6  bits: 136.2 E(32554): 2.3e-33
Smith-Waterman score: 559; 100.0% identity (100.0% similar) in 85 aa overlap (1-85:1-85)

               10        20        30        40        50        60
pF1KE1 MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS67 MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
               10        20        30        40        50        60

               70        80     
pF1KE1 INDRIGYKPQPKPNNRSSQFGSLEF
       :::::::::::::::::::::::::
CCDS67 INDRIGYKPQPKPNNRSSQFGSLEF
               70        80     




85 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 15:43:56 2016 done: Sun Nov  6 15:43:56 2016
 Total Scan time:  1.350 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]