FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1455, 100 aa
  1>>>pF1KE1455 100 - 100 aa - 100 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.7971+/-0.000663; mu= 4.5268+/- 0.040
 mean_var=128.5746+/-25.039, 0's: 0 Z-trim(115.0): 13  B-trim: 0 in 0/52
 Lambda= 0.113109
 statistics sampled from 15518 (15528) to 15518 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.801), E-opt: 0.2 (0.477), width:  16
 Scan time:  1.510

The best scores are:                                      opt bits E(32554)
CCDS33559.1 HMGN1 gene_id:3150|Hs108|chr21         ( 100)  625 111.3   1e-25


>>CCDS33559.1 HMGN1 gene_id:3150|Hs108|chr21              (100 aa)
 initn: 625 init1: 625 opt: 625  Z-score: 575.4  bits: 111.3 E(32554): 1e-25
Smith-Waterman score: 625; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100)

               10        20        30        40        50        60
pF1KE1 MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKG
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS33 MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKG
               10        20        30        40        50        60

               70        80        90       100
pF1KE1 KQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
       ::::::::::::::::::::::::::::::::::::::::
CCDS33 KQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
               70        80        90       100




100 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 03:09:58 2016 done: Mon Nov  7 03:09:58 2016
 Total Scan time:  1.510 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]