FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1405, 100 aa
  1>>>pF1KE1405 100 - 100 aa - 100 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8927+/-0.000293; mu= 11.8893+/- 0.018
 mean_var=58.0172+/-11.324, 0's: 0 Z-trim(116.8): 1  B-trim: 0 in 0/55
 Lambda= 0.168382
 statistics sampled from 28181 (28182) to 28181 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.735), E-opt: 0.2 (0.33), width:  16
 Scan time:  4.440

The best scores are:                                      opt bits E(85289)
NP_001634 (OMIM: 107670,143890) apolipoprotein A-I ( 100)  622 158.5 1.7e-39


>>NP_001634 (OMIM: 107670,143890) apolipoprotein A-II pr  (100 aa)
 initn: 622 init1: 622 opt: 622  Z-score: 830.0  bits: 158.5 E(85289): 1.7e-39
Smith-Waterman score: 622; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100)

               10        20        30        40        50        60
pF1KE1 MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_001 MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
               10        20        30        40        50        60

               70        80        90       100
pF1KE1 AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
       ::::::::::::::::::::::::::::::::::::::::
NP_001 AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
               70        80        90       100




100 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 02:21:18 2016 done: Mon Nov  7 02:21:19 2016
 Total Scan time:  4.440 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]