FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1301, 140 aa 1>>>pF1KE1301 140 - 140 aa - 140 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8445+/-0.000413; mu= 12.8098+/- 0.025 mean_var=52.3412+/-10.762, 0's: 0 Z-trim(110.2): 38 B-trim: 0 in 0/51 Lambda= 0.177277 statistics sampled from 18510 (18512) to 18510 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.592), E-opt: 0.2 (0.217), width: 16 Scan time: 4.550 The best scores are: opt bits E(85289) NP_009107 (OMIM: 604576) probable ergosterol biosy ( 140) 911 240.9 5.1e-64 >>NP_009107 (OMIM: 604576) probable ergosterol biosynthe (140 aa) initn: 911 init1: 911 opt: 911 Z-score: 1270.3 bits: 240.9 E(85289): 5.1e-64 Smith-Waterman score: 911; 100.0% identity (100.0% similar) in 140 aa overlap (1-140:1-140) 10 20 30 40 50 60 pF1KE1 MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_009 MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_009 SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILG 70 80 90 100 110 120 130 140 pF1KE1 MLVGLRYLEVEPVSRQKKRN :::::::::::::::::::: NP_009 MLVGLRYLEVEPVSRQKKRN 130 140 140 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 04:13:45 2016 done: Mon Nov 7 04:13:46 2016 Total Scan time: 4.550 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]