FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8847, 67 aa
  1>>>pF1KB8847 67 - 67 aa - 67 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0870+/-0.000484; mu= 7.8928+/- 0.029
 mean_var=55.7888+/-11.464, 0's: 0 Z-trim(115.6): 16  B-trim: 1447 in 2/51
 Lambda= 0.171712
 statistics sampled from 16136 (16151) to 16136 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.865), E-opt: 0.2 (0.496), width:  16
 Scan time:  1.230

The best scores are:                                      opt bits E(32554)
CCDS10427.1 GNG13 gene_id:51764|Hs108|chr16        (  67)  469 122.9 1.5e-29


>>CCDS10427.1 GNG13 gene_id:51764|Hs108|chr16             (67 aa)
 initn: 469 init1: 469 opt: 469  Z-score: 644.2  bits: 122.9 E(32554): 1.5e-29
Smith-Waterman score: 469; 100.0% identity (100.0% similar) in 67 aa overlap (1-67:1-67)

               10        20        30        40        50        60
pF1KB8 MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
               10        20        30        40        50        60

              
pF1KB8 KGKCTIL
       :::::::
CCDS10 KGKCTIL
              




67 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 00:29:35 2016 done: Sat Nov  5 00:29:35 2016
 Total Scan time:  1.230 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]