hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /data/smart.HMMs.bin
Sequence file:            /tmp/20080307/iprscan-20080307-03591234/chunk_1/iprscan-20080307-03591234.nocrc
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: pF1KB7515
Accession:      [none]
Description:    [none]

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
SM00338                                                  75.4      7e-18   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SM00338    1/1      33    97 ..     1    65 []    75.4    7e-18

Alignments of top-scoring domains:
SM00338: domain 1 of 1, from 33 to 97: score 75.4, E = 7e-18
                   *->ekdeKrrrRrerNReAArrsReRKkayieeLedkveeLeaENesLrk
                      e+d++++rRre+NR+AA+rsR++  ++ + L+++ e Le+EN+ Lr+
   pF1KB7515    33    EDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRR 79   

                   eleqLrreleklkselee<-*
                   e++ L++el++l++ l+e   
   pF1KB7515    80 EIGKLTEELKHLTEALKE    97   

//