FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0286, 69 aa
  1>>>pF1KE0286 69 - 69 aa - 69 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5569+/-0.00057; mu= 11.0453+/- 0.034
 mean_var=61.1088+/-11.750, 0's: 0 Z-trim(113.2): 27  B-trim: 52 in 1/49
 Lambda= 0.164067
 statistics sampled from 13873 (13899) to 13873 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.803), E-opt: 0.2 (0.427), width:  16
 Scan time:  1.280

The best scores are:                                      opt bits E(32554)
CCDS34474.1 DEFB114 gene_id:245928|Hs108|chr6      (  69)  499 125.2 3.2e-30


>>CCDS34474.1 DEFB114 gene_id:245928|Hs108|chr6           (69 aa)
 initn: 499 init1: 499 opt: 499  Z-score: 656.2  bits: 125.2 E(32554): 3.2e-30
Smith-Waterman score: 499; 100.0% identity (100.0% similar) in 69 aa overlap (1-69:1-69)

               10        20        30        40        50        60
pF1KE0 MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS34 MRIFYYLHFLCYVTFILPATCTLVNADRCTKRYGRCKRDCLESEKQIDICSLPRKICCTE
               10        20        30        40        50        60

                
pF1KE0 KLYEEDDMF
       :::::::::
CCDS34 KLYEEDDMF
                




69 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 17:41:18 2016 done: Thu Nov  3 17:41:18 2016
 Total Scan time:  1.280 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]