FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0249, 84 aa
  1>>>pF1KE0249 84 - 84 aa - 84 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.4857+/-0.000488; mu= 5.4413+/- 0.030
 mean_var=115.6322+/-23.102, 0's: 0 Z-trim(119.4): 1  B-trim: 0 in 0/54
 Lambda= 0.119271
 statistics sampled from 20664 (20665) to 20664 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.895), E-opt: 0.2 (0.635), width:  16
 Scan time:  1.570

The best scores are:                                      opt bits E(32554)
CCDS4551.1 KAAG1 gene_id:353219|Hs108|chr6         (  84)  589 109.7 2.1e-25


>>CCDS4551.1 KAAG1 gene_id:353219|Hs108|chr6              (84 aa)
 initn: 589 init1: 589 opt: 589  Z-score: 569.5  bits: 109.7 E(32554): 2.1e-25
Smith-Waterman score: 589; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84)

               10        20        30        40        50        60
pF1KE0 MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS45 MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRP
               10        20        30        40        50        60

               70        80    
pF1KE0 HRTQGAGSPPETNEKLTNPQVKEK
       ::::::::::::::::::::::::
CCDS45 HRTQGAGSPPETNEKLTNPQVKEK
               70        80    




84 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 19:15:31 2016 done: Thu Nov  3 19:15:31 2016
 Total Scan time:  1.570 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]