FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0224, 89 aa
  1>>>pF1KE0224 89 - 89 aa - 89 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0027+/-0.000732; mu= 9.2133+/- 0.044
 mean_var=46.6125+/- 9.513, 0's: 0 Z-trim(105.2): 11  B-trim: 0 in 0/50
 Lambda= 0.187855
 statistics sampled from 8317 (8322) to 8317 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.256), width:  16
 Scan time:  1.340

The best scores are:                                      opt bits E(32554)
CCDS8688.1 IAPP gene_id:3375|Hs108|chr12           (  89)  562 159.5 2.5e-40


>>CCDS8688.1 IAPP gene_id:3375|Hs108|chr12                (89 aa)
 initn: 562 init1: 562 opt: 562  Z-score: 837.4  bits: 159.5 E(32554): 2.5e-40
Smith-Waterman score: 562; 100.0% identity (100.0% similar) in 89 aa overlap (1-89:1-89)

               10        20        30        40        50        60
pF1KE0 MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS86 MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
               10        20        30        40        50        60

               70        80         
pF1KE0 SSTNVGSNTYGKRNAVEVLKREPLNYLPL
       :::::::::::::::::::::::::::::
CCDS86 SSTNVGSNTYGKRNAVEVLKREPLNYLPL
               70        80         




89 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sat Nov  5 01:21:29 2016 done: Sat Nov  5 01:21:29 2016
 Total Scan time:  1.340 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]