FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE0221, 96 aa
  1>>>pF1KE0221 96 - 96 aa - 96 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.7238+/-0.000553; mu= 11.3087+/- 0.033
 mean_var=51.1533+/-10.171, 0's: 0 Z-trim(112.1): 35  B-trim: 171 in 1/49
 Lambda= 0.179324
 statistics sampled from 12913 (12949) to 12913 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.78), E-opt: 0.2 (0.398), width:  16
 Scan time:  1.460

The best scores are:                                      opt bits E(32554)
CCDS11282.1 CCL1 gene_id:6346|Hs108|chr17          (  96)  670 180.2 1.7e-46


>>CCDS11282.1 CCL1 gene_id:6346|Hs108|chr17               (96 aa)
 initn: 670 init1: 670 opt: 670  Z-score: 948.0  bits: 180.2 E(32554): 1.7e-46
Smith-Waterman score: 670; 100.0% identity (100.0% similar) in 96 aa overlap (1-96:1-96)

               10        20        30        40        50        60
pF1KE0 MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
               10        20        30        40        50        60

               70        80        90      
pF1KE0 GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
       ::::::::::::::::::::::::::::::::::::
CCDS11 GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
               70        80        90      




96 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Nov  3 20:48:18 2016 done: Thu Nov  3 20:48:18 2016
 Total Scan time:  1.460 Total Display time:  0.000

Function used was FASTA [36.3.4 Apr, 2011]