FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query: pF1KE0215, 111 aa
1>>>pF1KE0215 111 - 111 aa - 111 aa
Library: human.CCDS.faa
18511270 residues in 32554 sequences
Statistics: Expectation_n fit: rho(ln(x))= 4.3442+/-0.00054; mu= 15.3066+/- 0.032
mean_var=55.2198+/-10.695, 0's: 0 Z-trim(112.9): 13 B-trim: 0 in 0/50
Lambda= 0.172594
statistics sampled from 13542 (13554) to 13542 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
ktup: 2, E-join: 1 (0.789), E-opt: 0.2 (0.416), width: 16
Scan time: 1.570
The best scores are: opt bits E(32554)
CCDS4188.1 CXCL14 gene_id:9547|Hs108|chr5 ( 111) 752 194.0 1.6e-50
>>CCDS4188.1 CXCL14 gene_id:9547|Hs108|chr5 (111 aa)
initn: 752 init1: 752 opt: 752 Z-score: 1020.7 bits: 194.0 E(32554): 1.6e-50
Smith-Waterman score: 752; 100.0% identity (100.0% similar) in 111 aa overlap (1-111:1-111)
10 20 30 40 50 60
pF1KE0 MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS41 MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKY
10 20 30 40 50 60
70 80 90 100 110
pF1KE0 PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
:::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS41 PHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
70 80 90 100 110
111 residues in 1 query sequences
18511270 residues in 32554 library sequences
Tcomplib [36.3.4 Apr, 2011] (8 proc)
start: Thu Nov 3 20:58:35 2016 done: Thu Nov 3 20:58:35 2016
Total Scan time: 1.570 Total Display time: -0.030
Function used was FASTA [36.3.4 Apr, 2011]