FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB9797, 100 aa
  1>>>pF1KB9797 100 - 100 aa - 100 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.9966+/-0.000572; mu= 7.7116+/- 0.035
 mean_var=94.4077+/-18.739, 0's: 0 Z-trim(115.1): 19  B-trim: 0 in 0/53
 Lambda= 0.131999
 statistics sampled from 15621 (15636) to 15621 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.822), E-opt: 0.2 (0.48), width:  16
 Scan time:  1.450

The best scores are:                                      opt bits E(32554)
CCDS14506.1 TCEAL7 gene_id:56849|Hs108|chrX        ( 100)  705 142.7 3.6e-35


>>CCDS14506.1 TCEAL7 gene_id:56849|Hs108|chrX             (100 aa)
 initn: 705 init1: 705 opt: 705  Z-score: 744.9  bits: 142.7 E(32554): 3.6e-35
Smith-Waterman score: 705; 100.0% identity (100.0% similar) in 100 aa overlap (1-100:1-100)

               10        20        30        40        50        60
pF1KB9 MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDE
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDE
               10        20        30        40        50        60

               70        80        90       100
pF1KB9 EMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI
       ::::::::::::::::::::::::::::::::::::::::
CCDS14 EMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI
               70        80        90       100




100 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 19:01:04 2016 done: Fri Nov  4 19:01:04 2016
 Total Scan time:  1.450 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]