FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB8739, 52 aa
  1>>>pF1KB8739 52 - 52 aa - 52 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 3.8897+/-0.000524; mu= 12.6776+/- 0.031
 mean_var=47.2731+/- 9.527, 0's: 0 Z-trim(112.6): 3  B-trim: 275 in 1/52
 Lambda= 0.186538
 statistics sampled from 13354 (13356) to 13354 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.805), E-opt: 0.2 (0.41), width:  16
 Scan time:  1.160

The best scores are:                                      opt bits E(32554)
CCDS5120.1 PLN gene_id:5350|Hs108|chr6             (  52)  330 94.8 2.6e-21


>>CCDS5120.1 PLN gene_id:5350|Hs108|chr6                  (52 aa)
 initn: 330 init1: 330 opt: 330  Z-score: 496.1  bits: 94.8 E(32554): 2.6e-21
Smith-Waterman score: 330; 100.0% identity (100.0% similar) in 52 aa overlap (1-52:1-52)

               10        20        30        40        50  
pF1KB8 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS51 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
               10        20        30        40        50  




52 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 15:07:18 2016 done: Fri Nov  4 15:07:18 2016
 Total Scan time:  1.160 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]