FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB7208, 106 aa
  1>>>pF1KB7208 106 - 106 aa - 106 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0376+/-0.000284; mu= 10.2874+/- 0.018
 mean_var=52.7644+/-10.766, 0's: 0 Z-trim(117.9): 1  B-trim: 1442 in 1/55
 Lambda= 0.176565
 statistics sampled from 30270 (30271) to 30270 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.752), E-opt: 0.2 (0.355), width:  16
 Scan time:  4.040

The best scores are:                                      opt bits E(85289)
NP_004669 (OMIM: 400013,415000) testis-specific ba ( 106)  704 186.5 6.9e-48


>>NP_004669 (OMIM: 400013,415000) testis-specific basic   (106 aa)
 initn: 704 init1: 704 opt: 704  Z-score: 980.7  bits: 186.5 E(85289): 6.9e-48
Smith-Waterman score: 704; 100.0% identity (100.0% similar) in 106 aa overlap (1-106:1-106)

               10        20        30        40        50        60
pF1KB7 MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNT
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_004 MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNT
               10        20        30        40        50        60

               70        80        90       100      
pF1KB7 LLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
       ::::::::::::::::::::::::::::::::::::::::::::::
NP_004 LLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK
               70        80        90       100      




106 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 20:22:40 2016 done: Fri Nov  4 20:22:41 2016
 Total Scan time:  4.040 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]