FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB6783, 121 aa
  1>>>pF1KB6783 121 - 121 aa - 121 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.9637+/-0.000347; mu= 11.4495+/- 0.021
 mean_var=53.4035+/-10.643, 0's: 0 Z-trim(113.2): 8  B-trim: 42 in 1/53
 Lambda= 0.175505
 statistics sampled from 22473 (22474) to 22473 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.663), E-opt: 0.2 (0.264), width:  16
 Scan time:  3.760

The best scores are:                                      opt bits E(85289)
NP_002938 (OMIM: 179837) replication protein A 14  ( 121)  813 213.5 6.6e-56


>>NP_002938 (OMIM: 179837) replication protein A 14 kDa   (121 aa)
 initn: 813 init1: 813 opt: 813  Z-score: 1124.7  bits: 213.5 E(85289): 6.6e-56
Smith-Waterman score: 813; 100.0% identity (100.0% similar) in 121 aa overlap (1-121:1-121)

               10        20        30        40        50        60
pF1KB6 MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_002 MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
               10        20        30        40        50        60

               70        80        90       100       110       120
pF1KB6 EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_002 EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH
               70        80        90       100       110       120

        
pF1KB6 D
       :
NP_002 D
        




121 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 23:59:56 2016 done: Fri Nov  4 23:59:57 2016
 Total Scan time:  3.760 Total Display time: -0.010

Function used was FASTA [36.3.4 Apr, 2011]