FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KB6729, 92 aa
  1>>>pF1KB6729 92 - 92 aa - 92 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.1200+/-0.0007; mu= 8.5257+/- 0.042
 mean_var=46.1407+/- 9.206, 0's: 0 Z-trim(106.4): 22  B-trim: 0 in 0/51
 Lambda= 0.188813
 statistics sampled from 8943 (8958) to 8943 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.687), E-opt: 0.2 (0.275), width:  16
 Scan time:  1.060

The best scores are:                                      opt bits E(32554)
CCDS30979.1 SNRPE gene_id:6635|Hs108|chr1          (  92)  601 170.8   1e-43


>>CCDS30979.1 SNRPE gene_id:6635|Hs108|chr1               (92 aa)
 initn: 601 init1: 601 opt: 601  Z-score: 898.2  bits: 170.8 E(32554): 1e-43
Smith-Waterman score: 601; 100.0% identity (100.0% similar) in 92 aa overlap (1-92:1-92)

               10        20        30        40        50        60
pF1KB6 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS30 MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
               10        20        30        40        50        60

               70        80        90  
pF1KB6 AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
       ::::::::::::::::::::::::::::::::
CCDS30 AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
               70        80        90  




92 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Fri Nov  4 23:39:52 2016 done: Fri Nov  4 23:39:53 2016
 Total Scan time:  1.060 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]