FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0533, 206 aa 1>>>pF1KE0533 206 - 206 aa - 206 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.7153+/-0.000294; mu= 9.6316+/- 0.018 mean_var=140.4479+/-28.581, 0's: 0 Z-trim(121.1): 5 B-trim: 867 in 1/58 Lambda= 0.108222 statistics sampled from 37222 (37229) to 37222 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.77), E-opt: 0.2 (0.437), width: 16 Scan time: 5.020 The best scores are: opt bits E(85289) NP_003767 (OMIM: 605089) 39S ribosomal protein L40 ( 206) 1349 220.9 1.1e-57 NP_001305080 (OMIM: 605089) 39S ribosomal protein ( 162) 1067 176.8 1.7e-44 NP_001305081 (OMIM: 605089) 39S ribosomal protein ( 162) 1067 176.8 1.7e-44 >>NP_003767 (OMIM: 605089) 39S ribosomal protein L40, mi (206 aa) initn: 1349 init1: 1349 opt: 1349 Z-score: 1156.4 bits: 220.9 E(85289): 1.1e-57 Smith-Waterman score: 1349; 100.0% identity (100.0% similar) in 206 aa overlap (1-206:1-206) 10 20 30 40 50 60 pF1KE0 MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE0 DQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 DQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKK 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE0 WSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 WSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTP 130 140 150 160 170 180 190 200 pF1KE0 PIPNYQPPEGRYNDITKVYTQVEFKR :::::::::::::::::::::::::: NP_003 PIPNYQPPEGRYNDITKVYTQVEFKR 190 200 >>NP_001305080 (OMIM: 605089) 39S ribosomal protein L40, (162 aa) initn: 1067 init1: 1067 opt: 1067 Z-score: 919.8 bits: 176.8 E(85289): 1.7e-44 Smith-Waterman score: 1067; 100.0% identity (100.0% similar) in 162 aa overlap (45-206:1-162) 20 30 40 50 60 70 pF1KE0 PTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKRKIRK :::::::::::::::::::::::::::::: NP_001 MRSEPLRKKKKVDPKKDQEAKERLKRKIRK 10 20 30 80 90 100 110 120 130 pF1KE0 LEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 LEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERD 40 50 60 70 80 90 140 150 160 170 180 190 pF1KE0 TIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYND :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 TIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYND 100 110 120 130 140 150 200 pF1KE0 ITKVYTQVEFKR :::::::::::: NP_001 ITKVYTQVEFKR 160 >>NP_001305081 (OMIM: 605089) 39S ribosomal protein L40, (162 aa) initn: 1067 init1: 1067 opt: 1067 Z-score: 919.8 bits: 176.8 E(85289): 1.7e-44 Smith-Waterman score: 1067; 100.0% identity (100.0% similar) in 162 aa overlap (45-206:1-162) 20 30 40 50 60 70 pF1KE0 PTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKRKIRK :::::::::::::::::::::::::::::: NP_001 MRSEPLRKKKKVDPKKDQEAKERLKRKIRK 10 20 30 80 90 100 110 120 130 pF1KE0 LEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 LEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERD 40 50 60 70 80 90 140 150 160 170 180 190 pF1KE0 TIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYND :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 TIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYND 100 110 120 130 140 150 200 pF1KE0 ITKVYTQVEFKR :::::::::::: NP_001 ITKVYTQVEFKR 160 206 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 01:01:54 2016 done: Thu Nov 3 01:01:55 2016 Total Scan time: 5.020 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]