FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE0533, 206 aa 1>>>pF1KE0533 206 - 206 aa - 206 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.0650+/-0.000755; mu= 7.3953+/- 0.046 mean_var=136.3569+/-27.366, 0's: 0 Z-trim(113.3): 8 B-trim: 191 in 2/52 Lambda= 0.109834 statistics sampled from 13977 (13984) to 13977 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.768), E-opt: 0.2 (0.43), width: 16 Scan time: 2.010 The best scores are: opt bits E(32554) CCDS13760.1 MRPL40 gene_id:64976|Hs108|chr22 ( 206) 1349 224.0 5e-59 >>CCDS13760.1 MRPL40 gene_id:64976|Hs108|chr22 (206 aa) initn: 1349 init1: 1349 opt: 1349 Z-score: 1173.3 bits: 224.0 E(32554): 5e-59 Smith-Waterman score: 1349; 100.0% identity (100.0% similar) in 206 aa overlap (1-206:1-206) 10 20 30 40 50 60 pF1KE0 MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS13 MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE0 DQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS13 DQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKK 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE0 WSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS13 WSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTP 130 140 150 160 170 180 190 200 pF1KE0 PIPNYQPPEGRYNDITKVYTQVEFKR :::::::::::::::::::::::::: CCDS13 PIPNYQPPEGRYNDITKVYTQVEFKR 190 200 206 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Thu Nov 3 01:01:54 2016 done: Thu Nov 3 01:01:54 2016 Total Scan time: 2.010 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]