Result of FASTA (omim) for pFN21AE1611
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1611, 115 aa
  1>>>pF1KE1611 115 - 115 aa - 115 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.5898+/-0.000329; mu= 12.9444+/- 0.020
 mean_var=46.6584+/- 9.509, 0's: 0 Z-trim(113.4): 12  B-trim: 0 in 0/49
 Lambda= 0.187763
 statistics sampled from 22752 (22755) to 22752 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.673), E-opt: 0.2 (0.267), width:  16
 Scan time:  4.250

The best scores are:                                      opt bits E(85289)
NP_000980 (OMIM: 180467) 60S ribosomal protein L30 ( 115)  739 207.2 4.7e-54


>>NP_000980 (OMIM: 180467) 60S ribosomal protein L30 [Ho  (115 aa)
 initn: 739 init1: 739 opt: 739  Z-score: 1091.3  bits: 207.2 E(85289): 4.7e-54
Smith-Waterman score: 739; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE1 MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEI
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE1 EYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 EYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGEK
               70        80        90       100       110     




115 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 09:41:05 2016 done: Sun Nov  6 09:41:06 2016
 Total Scan time:  4.250 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com