FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1639, 152 aa 1>>>pF1KE1639 152 - 152 aa - 152 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0545+/-0.000692; mu= 12.6189+/- 0.041 mean_var=55.0564+/-11.113, 0's: 0 Z-trim(108.5): 22 B-trim: 33 in 1/49 Lambda= 0.172850 statistics sampled from 10248 (10268) to 10248 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.694), E-opt: 0.2 (0.315), width: 16 Scan time: 1.740 The best scores are: opt bits E(32554) CCDS14319.1 PLP2 gene_id:5355|Hs108|chrX ( 152) 1020 261.9 1.1e-70 CCDS9598.1 CMTM5 gene_id:116173|Hs108|chr14 ( 156) 255 71.1 3e-13 >>CCDS14319.1 PLP2 gene_id:5355|Hs108|chrX (152 aa) initn: 1020 init1: 1020 opt: 1020 Z-score: 1382.4 bits: 261.9 E(32554): 1.1e-70 Smith-Waterman score: 1020; 100.0% identity (100.0% similar) in 152 aa overlap (1-152:1-152) 10 20 30 40 50 60 pF1KE1 MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILA 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 AIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 AIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLI 70 80 90 100 110 120 130 140 150 pF1KE1 ATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV :::::::::::::::::::::::::::::::: CCDS14 ATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV 130 140 150 >>CCDS9598.1 CMTM5 gene_id:116173|Hs108|chr14 (156 aa) initn: 225 init1: 202 opt: 255 Z-score: 351.3 bits: 71.1 E(32554): 3e-13 Smith-Waterman score: 255; 35.7% identity (73.2% similar) in 112 aa overlap (19-130:29-139) 10 20 30 40 50 pF1KE1 MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYS : ..::::: .:. : :.:.:::.:: .: CCDS95 MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYM 10 20 30 40 50 60 60 70 80 90 100 110 pF1KE1 SLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHS . ...:.... :. .: . . .. :::: ::.: . : :..:..:..... : . . CCDS95 AAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSR-DGA 70 80 90 100 110 120 130 140 150 pF1KE1 KIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV :.: :.:.: . .:.:::. CCDS95 AIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ 120 130 140 150 152 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 09:42:57 2016 done: Sun Nov 6 09:42:57 2016 Total Scan time: 1.740 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]