FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1619, 132 aa 1>>>pF1KE1619 132 - 132 aa - 132 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7306+/-0.000567; mu= 16.3641+/- 0.034 mean_var=83.4737+/-16.319, 0's: 0 Z-trim(115.2): 3 B-trim: 65 in 2/50 Lambda= 0.140378 statistics sampled from 15805 (15807) to 15805 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.831), E-opt: 0.2 (0.486), width: 16 Scan time: 1.640 The best scores are: opt bits E(32554) CCDS10839.1 AGRP gene_id:181|Hs108|chr16 ( 132) 918 193.9 2.4e-50 >>CCDS10839.1 AGRP gene_id:181|Hs108|chr16 (132 aa) initn: 918 init1: 918 opt: 918 Z-score: 1017.2 bits: 193.9 E(32554): 2.4e-50 Smith-Waterman score: 918; 100.0% identity (100.0% similar) in 132 aa overlap (1-132:1-132) 10 20 30 40 50 60 pF1KE1 MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS10 EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR 70 80 90 100 110 120 130 pF1KE1 KLGTAMNPCSRT :::::::::::: CCDS10 KLGTAMNPCSRT 130 132 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 09:50:36 2016 done: Sun Nov 6 09:50:37 2016 Total Scan time: 1.640 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]