FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5132, 110 aa 1>>>pF1KE5132 110 - 110 aa - 110 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.7967+/-0.000253; mu= 9.0662+/- 0.016 mean_var=86.2134+/-17.174, 0's: 0 Z-trim(122.9): 3 B-trim: 2286 in 1/54 Lambda= 0.138130 statistics sampled from 41862 (41865) to 41862 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.836), E-opt: 0.2 (0.491), width: 16 Scan time: 4.600 The best scores are: opt bits E(85289) NP_444513 (OMIM: 606634) dermcidin isoform 1 prepr ( 110) 717 151.1 3.4e-37 NP_001287783 (OMIM: 606634) dermcidin isoform 2 pr ( 121) 637 135.2 2.3e-32 >>NP_444513 (OMIM: 606634) dermcidin isoform 1 prepropro (110 aa) initn: 717 init1: 717 opt: 717 Z-score: 788.6 bits: 151.1 E(85289): 3.4e-37 Smith-Waterman score: 717; 100.0% identity (100.0% similar) in 110 aa overlap (1-110:1-110) 10 20 30 40 50 60 pF1KE5 MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_444 MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK 10 20 30 40 50 60 70 80 90 100 110 pF1KE5 QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL :::::::::::::::::::::::::::::::::::::::::::::::::: NP_444 QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL 70 80 90 100 110 >>NP_001287783 (OMIM: 606634) dermcidin isoform 2 prepro (121 aa) initn: 637 init1: 637 opt: 637 Z-score: 701.9 bits: 135.2 E(85289): 2.3e-32 Smith-Waterman score: 637; 100.0% identity (100.0% similar) in 97 aa overlap (1-97:1-97) 10 20 30 40 50 60 pF1KE5 MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK 10 20 30 40 50 60 70 80 90 100 110 pF1KE5 QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL ::::::::::::::::::::::::::::::::::::: NP_001 QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGGEERLVFGAPVNLTSIPLTSVSR 70 80 90 100 110 120 NP_001 P 110 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:40:57 2016 done: Mon Nov 7 21:40:58 2016 Total Scan time: 4.600 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]