FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1642, 156 aa 1>>>pF1KE1642 156 - 156 aa - 156 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.3586+/-0.000261; mu= 4.5964+/- 0.016 mean_var=148.1547+/-29.328, 0's: 0 Z-trim(125.1): 16 B-trim: 17 in 1/55 Lambda= 0.105370 statistics sampled from 48172 (48199) to 48172 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.849), E-opt: 0.2 (0.565), width: 16 Scan time: 4.960 The best scores are: opt bits E(85289) NP_003888 (OMIM: 602996) radiation-inducible immed ( 156) 1064 171.6 4.5e-43 >>NP_003888 (OMIM: 602996) radiation-inducible immediate (156 aa) initn: 1064 init1: 1064 opt: 1064 Z-score: 894.3 bits: 171.6 E(85289): 4.5e-43 Smith-Waterman score: 1064; 99.4% identity (99.4% similar) in 156 aa overlap (1-156:1-156) 10 20 30 40 50 60 pF1KE1 MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_003 RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL 70 80 90 100 110 120 130 140 150 pF1KE1 APTPVSPVLEPFNLTSEPSDYALDLSTFLQQHPAAF :::::: ::::::::::::::::::::::::::::: NP_003 APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF 130 140 150 156 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 09:58:38 2016 done: Sun Nov 6 09:58:39 2016 Total Scan time: 4.960 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]