FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1642, 156 aa 1>>>pF1KE1642 156 - 156 aa - 156 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.8474+/-0.000617; mu= 7.9496+/- 0.038 mean_var=144.2006+/-28.820, 0's: 0 Z-trim(117.6): 5 B-trim: 0 in 0/53 Lambda= 0.106805 statistics sampled from 18344 (18349) to 18344 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.852), E-opt: 0.2 (0.564), width: 16 Scan time: 2.150 The best scores are: opt bits E(32554) CCDS4689.1 IER3 gene_id:8870|Hs108|chr6 ( 156) 1064 173.6 4.3e-44 >>CCDS4689.1 IER3 gene_id:8870|Hs108|chr6 (156 aa) initn: 1064 init1: 1064 opt: 1064 Z-score: 905.1 bits: 173.6 E(32554): 4.3e-44 Smith-Waterman score: 1064; 99.4% identity (99.4% similar) in 156 aa overlap (1-156:1-156) 10 20 30 40 50 60 pF1KE1 MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS46 MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS46 RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL 70 80 90 100 110 120 130 140 150 pF1KE1 APTPVSPVLEPFNLTSEPSDYALDLSTFLQQHPAAF :::::: ::::::::::::::::::::::::::::: CCDS46 APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF 130 140 150 156 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 09:58:38 2016 done: Sun Nov 6 09:58:38 2016 Total Scan time: 2.150 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]