FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3017, 116 aa
  1>>>pF1KE3017 116 - 116 aa - 116 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2990+/-0.000568; mu= 11.2157+/- 0.034
 mean_var=71.6727+/-14.162, 0's: 0 Z-trim(113.7): 7  B-trim: 5 in 1/52
 Lambda= 0.151495
 statistics sampled from 14270 (14274) to 14270 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.807), E-opt: 0.2 (0.438), width:  16
 Scan time:  1.750

The best scores are:                                      opt bits E(32554)
CCDS3288.1 SST gene_id:6750|Hs108|chr3             ( 116)  764 174.8 1.1e-44


>>CCDS3288.1 SST gene_id:6750|Hs108|chr3                  (116 aa)
 initn: 764 init1: 764 opt: 764  Z-score: 915.9  bits: 174.8 E(32554): 1.1e-44
Smith-Waterman score: 764; 100.0% identity (100.0% similar) in 116 aa overlap (1-116:1-116)

               10        20        30        40        50        60
pF1KE3 MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS32 MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP
               10        20        30        40        50        60

               70        80        90       100       110      
pF1KE3 NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS32 NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
               70        80        90       100       110      




116 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 09:13:00 2016 done: Sun Nov  6 09:13:01 2016
 Total Scan time:  1.750 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]