Result of FASTA (ccds) for pFN21AE6545
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6545, 101 aa
  1>>>pF1KE6545 101 - 101 aa - 101 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.8561+/-0.000684; mu= 7.4327+/- 0.041
 mean_var=83.6708+/-17.362, 0's: 0 Z-trim(111.9): 7  B-trim: 48 in 1/50
 Lambda= 0.140213
 statistics sampled from 12776 (12781) to 12776 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.771), E-opt: 0.2 (0.393), width:  16
 Scan time:  1.340

The best scores are:                                      opt bits E(32554)
CCDS1829.1 CRIPT gene_id:9419|Hs108|chr2           ( 101)  710 152.1 5.2e-38


>>CCDS1829.1 CRIPT gene_id:9419|Hs108|chr2                (101 aa)
 initn: 710 init1: 710 opt: 710  Z-score: 795.8  bits: 152.1 E(32554): 5.2e-38
Smith-Waterman score: 710; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE6 MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS18 MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRI
               10        20        30        40        50        60

               70        80        90       100 
pF1KE6 CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
       :::::::::::::::::::::::::::::::::::::::::
CCDS18 CKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
               70        80        90       100 




101 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:16:56 2016 done: Tue Nov  8 14:16:57 2016
 Total Scan time:  1.340 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com