FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6688, 235 aa 1>>>pF1KE6688 235 - 235 aa - 235 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 8.5026+/-0.000835; mu= 4.7574+/- 0.051 mean_var=314.5607+/-62.607, 0's: 0 Z-trim(118.4): 16 B-trim: 0 in 0/54 Lambda= 0.072314 statistics sampled from 19287 (19303) to 19287 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.853), E-opt: 0.2 (0.593), width: 16 Scan time: 2.170 The best scores are: opt bits E(32554) CCDS45560.1 BHLHA9 gene_id:727857|Hs108|chr17 ( 235) 1657 184.9 4e-47 >>CCDS45560.1 BHLHA9 gene_id:727857|Hs108|chr17 (235 aa) initn: 1657 init1: 1657 opt: 1657 Z-score: 959.5 bits: 184.9 E(32554): 4e-47 Smith-Waterman score: 1657; 100.0% identity (100.0% similar) in 235 aa overlap (1-235:1-235) 10 20 30 40 50 60 pF1KE6 MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS45 MLRGAPGLGLTARKGAEDSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 VRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS45 VRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLV 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE6 LRASPAPRGPCGHLECHGPAARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS45 LRASPAPRGPCGHLECHGPAARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCP 130 140 150 160 170 180 190 200 210 220 230 pF1KE6 PHAPLARPSAVAEGPGLAQASGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS ::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS45 PHAPLARPSAVAEGPGLAQASGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS 190 200 210 220 230 235 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 15:25:24 2016 done: Tue Nov 8 15:25:24 2016 Total Scan time: 2.170 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]