Result of FASTA (ccds) for pFN21AE5144
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5144, 92 aa
  1>>>pF1KE5144 92 - 92 aa - 92 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6532+/-0.000504; mu= 12.2272+/- 0.030
 mean_var=54.7932+/-10.630, 0's: 0 Z-trim(113.7): 10  B-trim: 0 in 0/52
 Lambda= 0.173265
 statistics sampled from 14338 (14344) to 14338 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.825), E-opt: 0.2 (0.441), width:  16
 Scan time:  1.270

The best scores are:                                      opt bits E(32554)
CCDS43725.1 GNRH1 gene_id:2796|Hs108|chr8          (  92)  621 162.0 4.8e-41


>>CCDS43725.1 GNRH1 gene_id:2796|Hs108|chr8               (92 aa)
 initn: 621 init1: 621 opt: 621  Z-score: 850.4  bits: 162.0 E(32554): 4.8e-41
Smith-Waterman score: 621; 100.0% identity (100.0% similar) in 92 aa overlap (1-92:1-92)

               10        20        30        40        50        60
pF1KE5 MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS43 MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
               10        20        30        40        50        60

               70        80        90  
pF1KE5 FECTTHQPRSPLRDLKGALESLIEEETGQKKI
       ::::::::::::::::::::::::::::::::
CCDS43 FECTTHQPRSPLRDLKGALESLIEEETGQKKI
               70        80        90  




92 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 21:48:34 2016 done: Mon Nov  7 21:48:35 2016
 Total Scan time:  1.270 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com