FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE9252, 88 aa 1>>>pF1KE9252 88 - 88 aa - 88 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.4803+/-0.000299; mu= 12.2700+/- 0.019 mean_var=46.5942+/- 8.977, 0's: 0 Z-trim(116.3): 9 B-trim: 0 in 0/50 Lambda= 0.187892 statistics sampled from 27423 (27429) to 27423 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.732), E-opt: 0.2 (0.322), width: 16 Scan time: 4.200 The best scores are: opt bits E(85289) NP_001012525 (OMIM: 611264) centromere protein W i ( 88) 561 158.7 1.1e-39 NP_001273453 (OMIM: 611264) centromere protein W i ( 103) 306 89.6 8.2e-19 XP_016866334 (OMIM: 611264) PREDICTED: centromere ( 67) 264 78.1 1.5e-15 NP_001273454 (OMIM: 611264) centromere protein W i ( 67) 264 78.1 1.5e-15 >>NP_001012525 (OMIM: 611264) centromere protein W isofo (88 aa) initn: 561 init1: 561 opt: 561 Z-score: 833.3 bits: 158.7 E(85289): 1.1e-39 Smith-Waterman score: 561; 100.0% identity (100.0% similar) in 88 aa overlap (1-88:1-88) 10 20 30 40 50 60 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT 10 20 30 40 50 60 70 80 pF1KE9 NACASKCRVINKEHVLAAAKVILKKSRG :::::::::::::::::::::::::::: NP_001 NACASKCRVINKEHVLAAAKVILKKSRG 70 80 >>NP_001273453 (OMIM: 611264) centromere protein W isofo (103 aa) initn: 312 init1: 297 opt: 306 Z-score: 458.7 bits: 89.6 E(85289): 8.2e-19 Smith-Waterman score: 521; 85.4% identity (85.4% similar) in 103 aa overlap (1-88:1-103) 10 20 30 40 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLV---------------HL ::::::::::::::::::::::::::::::::::::::::::: :: NP_001 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVRFHPFSGWEWGTGEVHL 10 20 30 40 50 60 50 60 70 80 pF1KE9 NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG ::::::::::::::::::::::::::::::::::::::::::: NP_001 NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG 70 80 90 100 >>XP_016866334 (OMIM: 611264) PREDICTED: centromere prot (67 aa) initn: 264 init1: 264 opt: 264 Z-score: 400.0 bits: 78.1 E(85289): 1.5e-15 Smith-Waterman score: 264; 100.0% identity (100.0% similar) in 42 aa overlap (1-42:1-42) 10 20 30 40 50 60 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT :::::::::::::::::::::::::::::::::::::::::: XP_016 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLKSPGQTLVRVNVESLTRS 10 20 30 40 50 60 70 80 pF1KE9 NACASKCRVINKEHVLAAAKVILKKSRG XP_016 MYWPQQR >>NP_001273454 (OMIM: 611264) centromere protein W isofo (67 aa) initn: 264 init1: 264 opt: 264 Z-score: 400.0 bits: 78.1 E(85289): 1.5e-15 Smith-Waterman score: 264; 100.0% identity (100.0% similar) in 42 aa overlap (1-42:1-42) 10 20 30 40 50 60 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT :::::::::::::::::::::::::::::::::::::::::: NP_001 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLKSPGQTLVRVNVESLTRS 10 20 30 40 50 60 70 80 pF1KE9 NACASKCRVINKEHVLAAAKVILKKSRG NP_001 MYWPQQR 88 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 11:18:32 2016 done: Sun Nov 6 11:18:33 2016 Total Scan time: 4.200 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]