FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE9252, 88 aa 1>>>pF1KE9252 88 - 88 aa - 88 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.5537+/-0.000613; mu= 11.9920+/- 0.037 mean_var=48.9582+/- 9.410, 0's: 0 Z-trim(109.7): 8 B-trim: 0 in 0/49 Lambda= 0.183300 statistics sampled from 11087 (11091) to 11087 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.747), E-opt: 0.2 (0.341), width: 16 Scan time: 1.450 The best scores are: opt bits E(32554) CCDS34529.1 CENPW gene_id:387103|Hs108|chr6 ( 88) 561 155.1 5.2e-39 CCDS69196.1 CENPW gene_id:387103|Hs108|chr6 ( 103) 306 87.7 1.2e-18 CCDS75516.1 CENPW gene_id:387103|Hs108|chr6 ( 67) 264 76.5 1.8e-15 >>CCDS34529.1 CENPW gene_id:387103|Hs108|chr6 (88 aa) initn: 561 init1: 561 opt: 561 Z-score: 813.9 bits: 155.1 E(32554): 5.2e-39 Smith-Waterman score: 561; 100.0% identity (100.0% similar) in 88 aa overlap (1-88:1-88) 10 20 30 40 50 60 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS34 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT 10 20 30 40 50 60 70 80 pF1KE9 NACASKCRVINKEHVLAAAKVILKKSRG :::::::::::::::::::::::::::: CCDS34 NACASKCRVINKEHVLAAAKVILKKSRG 70 80 >>CCDS69196.1 CENPW gene_id:387103|Hs108|chr6 (103 aa) initn: 312 init1: 297 opt: 306 Z-score: 448.4 bits: 87.7 E(32554): 1.2e-18 Smith-Waterman score: 521; 85.4% identity (85.4% similar) in 103 aa overlap (1-88:1-103) 10 20 30 40 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLV---------------HL ::::::::::::::::::::::::::::::::::::::::::: :: CCDS69 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVRFHPFSGWEWGTGEVHL 10 20 30 40 50 60 50 60 70 80 pF1KE9 NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG ::::::::::::::::::::::::::::::::::::::::::: CCDS69 NCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG 70 80 90 100 >>CCDS75516.1 CENPW gene_id:387103|Hs108|chr6 (67 aa) initn: 264 init1: 264 opt: 264 Z-score: 391.2 bits: 76.5 E(32554): 1.8e-15 Smith-Waterman score: 264; 100.0% identity (100.0% similar) in 42 aa overlap (1-42:1-42) 10 20 30 40 50 60 pF1KE9 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRT :::::::::::::::::::::::::::::::::::::::::: CCDS75 MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLKSPGQTLVRVNVESLTRS 10 20 30 40 50 60 70 80 pF1KE9 NACASKCRVINKEHVLAAAKVILKKSRG CCDS75 MYWPQQR 88 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 11:18:32 2016 done: Sun Nov 6 11:18:32 2016 Total Scan time: 1.450 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]