FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6172, 82 aa 1>>>pF1KE6172 82 - 82 aa - 82 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.5683+/-0.000318; mu= 10.9890+/- 0.019 mean_var=44.7634+/- 9.446, 0's: 0 Z-trim(115.3): 13 B-trim: 584 in 1/54 Lambda= 0.191696 statistics sampled from 25703 (25716) to 25703 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.712), E-opt: 0.2 (0.302), width: 16 Scan time: 2.310 The best scores are: opt bits E(85289) NP_055217 (OMIM: 612080,615159) cytochrome b-c1 co ( 82) 556 160.4 2.9e-40 >>NP_055217 (OMIM: 612080,615159) cytochrome b-c1 comple (82 aa) initn: 556 init1: 556 opt: 556 Z-score: 843.9 bits: 160.4 E(85289): 2.9e-40 Smith-Waterman score: 556; 100.0% identity (100.0% similar) in 82 aa overlap (1-82:1-82) 10 20 30 40 50 60 pF1KE6 MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_055 MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY 10 20 30 40 50 60 70 80 pF1KE6 TWGTEEFERSKRKNPAAYENDK :::::::::::::::::::::: NP_055 TWGTEEFERSKRKNPAAYENDK 70 80 82 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:03:42 2016 done: Tue Nov 8 10:03:43 2016 Total Scan time: 2.310 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]