FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2269, 84 aa 1>>>pF1KE2269 84 - 84 aa - 84 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0276+/-0.00049; mu= 9.6763+/- 0.030 mean_var=52.5773+/-10.493, 0's: 0 Z-trim(114.1): 9 B-trim: 0 in 0/50 Lambda= 0.176879 statistics sampled from 14722 (14728) to 14722 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.823), E-opt: 0.2 (0.452), width: 16 Scan time: 1.240 The best scores are: opt bits E(32554) CCDS34224.1 CDC42SE2 gene_id:56990|Hs108|chr5 ( 84) 590 157.2 1.1e-39 CCDS981.1 CDC42SE1 gene_id:56882|Hs108|chr1 ( 79) 282 78.6 4.9e-16 >>CCDS34224.1 CDC42SE2 gene_id:56990|Hs108|chr5 (84 aa) initn: 590 init1: 590 opt: 590 Z-score: 825.8 bits: 157.2 E(32554): 1.1e-39 Smith-Waterman score: 590; 100.0% identity (100.0% similar) in 84 aa overlap (1-84:1-84) 10 20 30 40 50 60 pF1KE2 MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQM :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS34 MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQM 10 20 30 40 50 60 70 80 pF1KE2 QSKGGYGGGMPANVQMQLVDTKAG :::::::::::::::::::::::: CCDS34 QSKGGYGGGMPANVQMQLVDTKAG 70 80 >>CCDS981.1 CDC42SE1 gene_id:56882|Hs108|chr1 (79 aa) initn: 305 init1: 152 opt: 282 Z-score: 401.5 bits: 78.6 E(32554): 4.9e-16 Smith-Waterman score: 282; 56.7% identity (85.1% similar) in 67 aa overlap (1-64:1-67) 10 20 30 40 50 pF1KE2 MSEFWLCFNCCIAEQPQPKR-RRRIDRSMIGEPTNFVHTAHVGSGDLFSG--MNSVSSIQ ::::: ..::..:.::::. ::::::.::::: :::: .:.:::.. .: . ....: CCDS98 MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQ 10 20 30 40 50 60 60 70 80 pF1KE2 NQMQSKGGYGGGMPANVQMQLVDTKAG .::.::: CCDS98 EQMRSKGNRDRPWSNSRGL 70 84 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 11:20:10 2016 done: Sun Nov 6 11:20:10 2016 Total Scan time: 1.240 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]