Result of FASTA (ccds) for pFN21AE5179
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5179, 110 aa
  1>>>pF1KE5179 110 - 110 aa - 110 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.0640+/-0.00071; mu= 10.1766+/- 0.042
 mean_var=46.6787+/- 9.197, 0's: 0 Z-trim(106.9): 15  B-trim: 0 in 0/49
 Lambda= 0.187722
 statistics sampled from 9241 (9242) to 9241 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.692), E-opt: 0.2 (0.284), width:  16
 Scan time:  1.420

The best scores are:                                      opt bits E(32554)
CCDS33930.1 RPL35A gene_id:6165|Hs108|chr3         ( 110)  737 206.6 2.5e-54


>>CCDS33930.1 RPL35A gene_id:6165|Hs108|chr3              (110 aa)
 initn: 737 init1: 737 opt: 737  Z-score: 1088.8  bits: 206.6 E(32554): 2.5e-54
Smith-Waterman score: 737; 100.0% identity (100.0% similar) in 110 aa overlap (1-110:1-110)

               10        20        30        40        50        60
pF1KE5 MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS33 MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTP
               10        20        30        40        50        60

               70        80        90       100       110
pF1KE5 GGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI
       ::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS33 GGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI
               70        80        90       100       110




110 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Mon Nov  7 22:20:12 2016 done: Mon Nov  7 22:20:12 2016
 Total Scan time:  1.420 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com